PNPLA3 / Unconjugated /
Product Details
| Description | VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104. Mouse Q91WW7 | |
|---|---|---|
| Conjugate | Unconjugated | |
| Clone | ||
| Target Species | Mouse | |
| Applications | IHC-P, WB, IHC | |
| Supplier | Novus Biologicals | |
| Catalog # | Sign in to view product details, citations, and spectra | |
| Size | ||
| Price | ||
| Antigen | ||
| Host | ||
| Isotype |
About PNPLA3
The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. [provided by RefSeq, Jul 2008]
Experiment Design Tools
Panel Builders
Looking to design a Microscopy or Flow Cytometry experiment?
Validation References
| Additional Sources |
|
|---|
Reviews & Ratings
| Reviews |
|---|
Looking for more options?
149 PNPLA3 antibodies from over 13 suppliers available with over 16 conjugates.
